Custom peptide: Sequence MTELNKKLQNSLHGYDILDAQQLSEVDGGIAPLLIAGGIVLAGGGGFAAGYGLSRWLG, 5 MG

https://www.micromed-it.com/web/image/product.template/6173/image_1920?unique=5bc509a

999.00 € 999.0 EUR 999.00 €

999.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days