Customer service:Sequence , MSLKNNIVGFNKLDSEELKNINGGCYPLLIIGALAGIAIRNRIKK 90% purity, 3 mg

https://www.electalab.com/web/image/product.template/6186/image_1920?unique=5bc509a

710.00 € 710.0 EUR 710.00 €

710.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days