Skip to Content

Amyloid Betasize:Peptide 1size:40 human size:size:> C194H295N53O58S1 NH2size:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVsize:COOH Purity: 95% size: 10x1mg

https://www.bioisis.net/web/image/product.template/4845/image_1920?unique=150d2ef
(0 review)

795.00 € 795.0 EUR 795.00 €

795.00 €

Not Available For Sale

(0.00 € / Units)

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: 0399-CSB-DT1441-10mg
Website URL: /shop/0399-csb-dt1441-10mg-amyloid-betasize-peptide-1size-40-human-size-size-c194h295n53o58s1-nh2size-daefrhdsgyevhhqklvffaedvgsnkgaiiglmvggvvsize-cooh-purity-95-size-10x1mg-4845

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.