Customer service:Sequence , MALFKELSNKELVNVNGGVVPVAVVLGVPTLALGIYQAGYAAGKDRAQAGLRR, 90% purity, 3MG

https://wiem.odoo.com/web/image/product.template/6180/image_1920?unique=5bc509a

889.00 € 889.0 EUR 889.00 €

889.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days